Skip to main content Skip to footer
HomeHome
 
  • Homepage
  • Searching for patents

    Patent knowledge

    Access our patent databases and search tools.

    Go to overview 

    • Overview
    • Technical information
      • Overview
      • Espacenet - patent search
      • European Publication Server
      • EP full-text search
    • Legal information
      • Overview
      • European Patent Register
      • European Patent Bulletin
      • European Case Law Identifier sitemap
      • Third-party observations
    • Business information
      • Overview
      • PATSTAT
      • IPscore
      • Technology insight reports
    • Data
      • Overview
      • Technology Intelligence Platform
      • Linked open EP data
      • Bulk data sets
      • Web services
      • Coverage, codes and statistics
    • Technology platforms
      • Overview
      • Plastics in transition
      • Water innovation
      • Space innovation
      • Technologies combatting cancer
      • Firefighting technologies
      • Clean energy technologies
      • Fighting coronavirus
    • Helpful resources
      • Overview
      • First time here?
      • Asian patent information
      • Patent information centres
      • Patent Translate
      • Patent Knowledge News
      • Business and statistics
      • Unitary Patent information in patent knowledge
    Image
    Plastics in Transition

    Technology insight report on plastic waste management

  • Applying for a patent

    Applying for a patent

    Practical information on filing and grant procedures.

    Go to overview 

    • Overview
    • European route
      • Overview
      • European Patent Guide
      • Oppositions
      • Oral proceedings
      • Appeals
      • Unitary Patent & Unified Patent Court
      • National validation
      • Request for extension/validation
    • International route (PCT)
      • Overview
      • Euro-PCT Guide – PCT procedure at the EPO
      • EPO decisions and notices
      • PCT provisions and resources
      • Extension/validation request
      • Reinforced partnership programme
      • Accelerating your PCT application
      • Patent Prosecution Highway (PPH)
      • Training and events
    • National route
    • Find a professional representative
    • MyEPO services
      • Overview
      • Understand our services
      • Get access
      • File with us
      • Interact with us on your files
      • Online Filing & fee payment outages
    • Forms
      • Overview
      • Request for examination
    • Fees
      • Overview
      • European fees (EPC)
      • International fees (PCT)
      • Unitary Patent fees (UP)
      • Fee payment and refunds
      • Warning

    UP

    Find out how the Unitary Patent can enhance your IP strategy

  • Law & practice

    Law & practice

    European patent law, the Official Journal and other legal texts.

    Go to overview 

    • Overview
    • Legal texts
      • Overview
      • European Patent Convention
      • Official Journal
      • Guidelines
      • Extension / validation system
      • London Agreement
      • National law relating to the EPC
      • Unitary patent system
      • National measures relating to the Unitary Patent
    • Court practices
      • Overview
      • European Patent Judges' Symposium
    • User consultations
      • Overview
      • Ongoing consultations
      • Completed consultations
    • Substantive patent law harmonisation
      • Overview
      • The Tegernsee process
      • Group B+
    • Convergence of practice
    • Options for professional representatives
    Image
    Law and practice scales 720x237

    Keep up with key aspects of selected BoA decisions with our monthly "Abstracts of decisions”

  • News & events

    News & events

    Our latest news, podcasts and events, including the European Inventor Award.

    Go to overview 

     

    • Overview
    • News
    • Events
    • European Inventor Award
      • Overview
      • The meaning of tomorrow
      • About the award
      • Categories and prizes
      • Meet the finalists
      • Nominations
      • European Inventor Network
      • The 2024 event
    • Young Inventor Prize
      • Overview
      • About the prize
      • Nominations
      • The jury
      • The world, reimagined
    • Press centre
      • Overview
      • Patent Index and statistics
      • Search in press centre
      • Background information
      • Copyright
      • Press contacts
      • Call back form
      • Email alert service
    • Innovation and patenting in focus
      • Overview
      • Water-related technologies
      • CodeFest
      • Green tech in focus
      • Research institutes
      • Women inventors
      • Lifestyle
      • Space and satellites
      • The future of medicine
      • Materials science
      • Mobile communications
      • Biotechnology
      • Patent classification
      • Digital technologies
      • The future of manufacturing
      • Books by EPO experts
    • "Talk innovation" podcast

    Podcast

    From ideas to inventions: tune into our podcast for the latest in tech and IP

  • Learning

    Learning

    The European Patent Academy – the point of access to your learning

    Go to overview 

    • Overview
    • Learning activities and paths
      • Overview
      • Learning activities
      • Learning paths
    • EQE and EPAC
      • Overview
      • EQE - European qualifying examination
      • EPAC - European patent administration certification
      • CSP – Candidate Support Programme
    • Learning resources by area of interest
      • Overview
      • Patent granting
      • Technology transfer and dissemination
      • Patent enforcement and litigation
    • Learning resources by profile
      • Overview
      • Business and IP managers
      • EQE and EPAC Candidates
      • Judges, lawyers and prosecutors
      • National offices and IP authorities
      • Patent attorneys and paralegals
      • Universities, research centres and technology transfer centres (TTOs)
    Image
    Patent Academy catalogue

    Have a look at the extensive range of learning opportunities in the European Patent Academy training catalogue

  • About us

    About us

    Find out more about our work, values, history and vision

    Go to overview 

    • Overview
    • The EPO at a glance
    • 50 years of the EPC
      • Overview
      • Official celebrations
      • Member states’ video statements
      • 50 Leading Tech Voices
      • Athens Marathon
      • Kids’ collaborative art competition
    • Legal foundations and member states
      • Overview
      • Legal foundations
      • Member states of the European Patent Organisation
      • Extension states
      • Validation states
    • Administrative Council and subsidiary bodies
      • Overview
      • Communiqués
      • Calendar
      • Documents and publications
      • Administrative Council
    • Principles & strategy
      • Overview
      • Our mission, vision, values and corporate policy
      • Strategic Plan 2028
      • Towards a New Normal
    • Leadership & management
      • Overview
      • President António Campinos
      • Management Advisory Committee
    • Sustainability at the EPO
      • Overview
      • Environmental
      • Social
      • Governance and Financial sustainability
    • Services & activities
      • Overview
      • Our services & structure
      • Quality
      • Consulting our users
      • European and international co-operation
      • European Patent Academy
      • Chief Economist
      • Ombuds Office
      • Reporting wrongdoing
    • Observatory on Patents and Technology
      • Overview
      • Innovation actors
      • Policy and funding
      • Tools
      • About the Observatory
    • Procurement
      • Overview
      • Procurement forecast
      • Doing business with the EPO
      • Procurement procedures
      • Sustainable Procurement Policy
      • About eTendering and electronic signatures
      • Procurement portal
      • Invoicing
      • General conditions
      • Archived tenders
    • Transparency portal
      • Overview
      • General
      • Human
      • Environmental
      • Organisational
      • Social and relational
      • Economic
      • Governance
    • Statistics and trends
      • Overview
      • Statistics & Trends Centre
      • Patent Index 2024
      • EPO Data Hub
      • Clarification on data sources
    • History
      • Overview
      • 1970s
      • 1980s
      • 1990s
      • 2000s
      • 2010s
      • 2020s
    • Art collection
      • Overview
      • The collection
      • Let's talk about art
      • Artists
      • Media library
      • What's on
      • Publications
      • Contact
      • Culture Space A&T 5-10
      • "Long Night"
    Image
    Patent Index 2024 keyvisual showing brightly lit up data chip, tinted in purple, bright blue

    Track the latest tech trends with our Patent Index

 
Website
cancel
en de fr
  • Language selection
  • English
  • Deutsch
  • Français
Main navigation
  • Homepage
    • Go back
    • New to patents
  • New to patents
    • Go back
    • Your business and patents
    • Why do we have patents?
    • What's your big idea?
    • Are you ready?
    • What to expect
    • How to apply for a patent
    • Is it patentable?
    • Are you first?
    • Patent quiz
    • Unitary patent video
  • Searching for patents
    • Go back
    • Overview
    • Technical information
      • Go back
      • Overview
      • Espacenet - patent search
        • Go back
        • Overview
        • National patent office databases
        • Global Patent Index (GPI)
        • Release notes
      • European Publication Server
        • Go back
        • Overview
        • Release notes
        • Cross-reference index for Euro-PCT applications
        • EP authority file
        • Help
      • EP full-text search
    • Legal information
      • Go back
      • Overview
      • European Patent Register
        • Go back
        • Overview
        • Release notes archive
        • Register documentation
          • Go back
          • Overview
          • Deep link data coverage
          • Federated Register
          • Register events
      • European Patent Bulletin
        • Go back
        • Overview
        • Download Bulletin
        • EP Bulletin search
        • Help
      • European Case Law Identifier sitemap
      • Third-party observations
    • Business information
      • Go back
      • Overview
      • PATSTAT
      • IPscore
        • Go back
        • Release notes
      • Technology insight reports
    • Data
      • Go back
      • Overview
      • Technology Intelligence Platform
      • Linked open EP data
      • Bulk data sets
        • Go back
        • Overview
        • Manuals
        • Sequence listings
        • National full-text data
        • European Patent Register data
        • EPO worldwide bibliographic data (DOCDB)
        • EP full-text data
        • EPO worldwide legal event data (INPADOC)
        • EP bibliographic data (EBD)
        • Boards of Appeal decisions
      • Web services
        • Go back
        • Overview
        • Open Patent Services (OPS)
        • European Publication Server web service
      • Coverage, codes and statistics
        • Go back
        • Weekly updates
        • Updated regularly
    • Technology platforms
      • Go back
      • Overview
      • Plastics in transition
        • Go back
        • Overview
        • Plastics waste recovery
        • Plastics waste recycling
        • Alternative plastics
      • Innovation in water technologies
        • Go back
        • Overview
        • Clean water
        • Protection from water
      • Space innovation
        • Go back
        • Overview
        • Cosmonautics
        • Space observation
      • Technologies combatting cancer
        • Go back
        • Overview
        • Prevention and early detection
        • Diagnostics
        • Therapies
        • Wellbeing and aftercare
      • Firefighting technologies
        • Go back
        • Overview
        • Detection and prevention of fires
        • Fire extinguishing
        • Protective equipment
        • Post-fire restoration
      • Clean energy technologies
        • Go back
        • Overview
        • Renewable energy
        • Carbon-intensive industries
        • Energy storage and other enabling technologies
      • Fighting coronavirus
        • Go back
        • Overview
        • Vaccines and therapeutics
          • Go back
          • Overview
          • Vaccines
          • Overview of candidate therapies for COVID-19
          • Candidate antiviral and symptomatic therapeutics
          • Nucleic acids and antibodies to fight coronavirus
        • Diagnostics and analytics
          • Go back
          • Overview
          • Protein and nucleic acid assays
          • Analytical protocols
        • Informatics
          • Go back
          • Overview
          • Bioinformatics
          • Healthcare informatics
        • Technologies for the new normal
          • Go back
          • Overview
          • Devices, materials and equipment
          • Procedures, actions and activities
          • Digital technologies
        • Inventors against coronavirus
    • Helpful resources
      • Go back
      • Overview
      • First time here?
        • Go back
        • Overview
        • Basic definitions
        • Patent classification
          • Go back
          • Overview
          • Cooperative Patent Classification (CPC)
        • Patent families
          • Go back
          • Overview
          • DOCDB simple patent family
          • INPADOC extended patent family
        • Legal event data
          • Go back
          • Overview
          • INPADOC classification scheme
      • Asian patent information
        • Go back
        • Overview
        • China (CN)
          • Go back
          • Overview
          • Facts and figures
          • Grant procedure
          • Numbering system
          • Useful terms
          • Searching in databases
        • Chinese Taipei (TW)
          • Go back
          • Overview
          • Grant procedure
          • Numbering system
          • Useful terms
          • Searching in databases
        • India (IN)
          • Go back
          • Overview
          • Facts and figures
          • Grant procedure
          • Numbering system
        • Japan (JP)
          • Go back
          • Overview
          • Facts and figures
          • Grant procedure
          • Numbering system
          • Useful terms
          • Searching in databases
        • Korea (KR)
          • Go back
          • Overview
          • Facts and figures
          • Grant procedure
          • Numbering system
          • Useful terms
          • Searching in databases
        • Russian Federation (RU)
          • Go back
          • Overview
          • Facts and figures
          • Numbering system
          • Searching in databases
        • Useful links
      • Patent information centres (PATLIB)
      • Patent Translate
      • Patent Knowledge News
      • Business and statistics
      • Unitary Patent information in patent knowledge
  • Applying for a patent
    • Go back
    • Overview
    • European route
      • Go back
      • Overview
      • European Patent Guide
      • Oppositions
      • Oral proceedings
        • Go back
        • Oral proceedings calendar
          • Go back
          • Calendar
          • Public access to appeal proceedings
          • Public access to opposition proceedings
          • Technical guidelines
      • Appeals
      • Unitary Patent & Unified Patent Court
        • Go back
        • Overview
        • Unitary Patent
          • Go back
          • Overview
          • Legal framework
          • Main features
          • Applying for a Unitary Patent
          • Cost of a Unitary Patent
          • Translation and compensation
          • Start date
          • Introductory brochures
        • Unified Patent Court
      • National validation
      • Extension/validation request
    • International route
      • Go back
      • Overview
      • Euro-PCT Guide
      • Entry into the European phase
      • Decisions and notices
      • PCT provisions and resources
      • Extension/validation request
      • Reinforced partnership programme
      • Accelerating your PCT application
      • Patent Prosecution Highway (PPH)
        • Go back
        • Patent Prosecution Highway (PPH) programme outline
      • Training and events
    • National route
    • MyEPO services
      • Go back
      • Overview
      • Understand our services
        • Go back
        • Overview
        • Exchange data with us using an API
          • Go back
          • Release notes
      • Get access
        • Go back
        • Overview
        • Release notes
      • File with us
        • Go back
        • Overview
        • What if our online filing services are down?
        • Release notes
      • Interact with us on your files
        • Go back
        • Release notes
      • Online Filing & fee payment outages
    • Fees
      • Go back
      • Overview
      • European fees (EPC)
        • Go back
        • Overview
        • Decisions and notices
      • International fees (PCT)
        • Go back
        • Reduction in fees
        • Fees for international applications
        • Decisions and notices
        • Overview
      • Unitary Patent fees (UP)
        • Go back
        • Overview
        • Decisions and notices
      • Fee payment and refunds
        • Go back
        • Overview
        • Payment methods
        • Getting started
        • FAQs and other documentation
        • Technical information for batch payments
        • Decisions and notices
        • Release notes
      • Warning
    • Forms
      • Go back
      • Overview
      • Request for examination
    • Find a professional representative
  • Law & practice
    • Go back
    • Overview
    • Legal texts
      • Go back
      • Overview
      • European Patent Convention
        • Go back
        • Overview
        • Archive
          • Go back
          • Overview
          • Documentation on the EPC revision 2000
            • Go back
            • Overview
            • Diplomatic Conference for the revision of the EPC
            • Travaux préparatoires
            • New text
            • Transitional provisions
            • Implementing regulations to the EPC 2000
            • Rules relating to Fees
            • Ratifications and accessions
          • Travaux Préparatoires EPC 1973
      • Official Journal
      • Guidelines
        • Go back
        • Overview
        • EPC Guidelines
        • PCT-EPO Guidelines
        • Unitary Patent Guidelines
        • Guidelines revision cycle
        • Consultation results
        • Summary of user responses
        • Archive
      • Extension / validation system
      • London Agreement
      • National law relating to the EPC
        • Go back
        • Overview
        • Archive
      • Unitary Patent system
        • Go back
        • Travaux préparatoires to UP and UPC
      • National measures relating to the Unitary Patent 
    • Court practices
      • Go back
      • Overview
      • European Patent Judges' Symposium
    • User consultations
      • Go back
      • Overview
      • Ongoing consultations
      • Completed consultations
    • Substantive patent law harmonisation
      • Go back
      • Overview
      • The Tegernsee process
      • Group B+
    • Convergence of practice
    • Options for professional representatives
  • News & events
    • Go back
    • Overview
    • News
    • Events
    • European Inventor Award
      • Go back
      • Overview
      • The meaning of tomorrow
      • About the award
      • Categories and prizes
      • Meet the inventors
      • Nominations
      • European Inventor Network
        • Go back
        • 2024 activities
        • 2025 activities
        • Rules and criteria
        • FAQ
      • The 2024 event
    • Young Inventors Prize
      • Go back
      • Overview
      • About the prize
      • Nominations
      • The jury
      • The world, reimagined
      • The 2025 event
    • Press centre
      • Go back
      • Overview
      • Patent Index and statistics
      • Search in press centre
      • Background information
        • Go back
        • Overview
        • European Patent Office
        • Q&A on patents related to coronavirus
        • Q&A on plant patents
      • Copyright
      • Press contacts
      • Call back form
      • Email alert service
    • In focus
      • Go back
      • Overview
      • Water-related technologies
      • CodeFest
        • Go back
        • CodeFest Spring 2025 on classifying patent data for sustainable development
        • Overview
        • CodeFest 2024 on generative AI
        • CodeFest 2023 on Green Plastics
      • Green tech in focus
        • Go back
        • Overview
        • About green tech
        • Renewable energies
        • Energy transition technologies
        • Building a greener future
      • Research institutes
      • Women inventors
      • Lifestyle
      • Space and satellites
        • Go back
        • Overview
        • Patents and space technologies
      • Healthcare
        • Go back
        • Overview
        • Medical technologies and cancer
        • Personalised medicine
      • Materials science
        • Go back
        • Overview
        • Nanotechnology
      • Mobile communications
      • Biotechnology
        • Go back
        • Overview
        • Red, white or green
        • The role of the EPO
        • What is patentable?
        • Biotech inventors
      • Classification
        • Go back
        • Overview
        • Nanotechnology
        • Climate change mitigation technologies
          • Go back
          • Overview
          • External partners
          • Updates on Y02 and Y04S
      • Digital technologies
        • Go back
        • Overview
        • About ICT
        • Hardware and software
        • Artificial intelligence
        • Fourth Industrial Revolution
      • Additive manufacturing
        • Go back
        • Overview
        • About AM
        • AM innovation
      • Books by EPO experts
    • Podcast
  • Learning
    • Go back
    • Overview
    • Learning activities and paths
      • Go back
      • Overview
      • Learning activities: types and formats
      • Learning paths
    • EQE and EPAC
      • Go back
      • Overview
      • EQE - European Qualifying Examination
        • Go back
        • Overview
        • Compendium
          • Go back
          • Overview
          • Paper F
          • Paper A
          • Paper B
          • Paper C
          • Paper D
          • Pre-examination
        • Candidates successful in the European qualifying examination
        • Archive
      • EPAC - European patent administration certification
      • CSP – Candidate Support Programme
    • Learning resources by area of interest
      • Go back
      • Overview
      • Patent granting
      • Technology transfer and dissemination
      • Patent enforcement and litigation
    • Learning resources by profile
      • Go back
      • Overview
      • Business and IP managers
        • Go back
        • Overview
        • Innovation case studies
          • Go back
          • Overview
          • SME case studies
          • Technology transfer case studies
          • High-growth technology case studies
        • Inventor's handbook
          • Go back
          • Overview
          • Introduction
          • Disclosure and confidentiality
          • Novelty and prior art
          • Competition and market potential
          • Assessing the risk ahead
          • Proving the invention
          • Protecting your idea
          • Building a team and seeking funding
          • Business planning
          • Finding and approaching companies
          • Dealing with companies
        • Best of search matters
          • Go back
          • Overview
          • Tools and databases
          • EPO procedures and initiatives
          • Search strategies
          • Challenges and specific topics
        • Support for high-growth technology businesses
          • Go back
          • Overview
          • Business decision-makers
          • IP professionals
          • Stakeholders of the Innovation Ecosystem
      • EQE and EPAC Candidates
        • Go back
        • Overview
        • Paper F brain-teasers
        • Daily D questions
        • European qualifying examination - Guide for preparation
        • EPAC
      • Judges, lawyers and prosecutors
        • Go back
        • Overview
        • Compulsory licensing in Europe
        • The jurisdiction of European courts in patent disputes
      • National offices and IP authorities
        • Go back
        • Overview
        • Learning material for examiners of national officers
        • Learning material for formalities officers and paralegals
      • Patent attorneys and paralegals
      • Universities, research centres and TTOs
        • Go back
        • Overview
        • Modular IP Education Framework (MIPEF)
        • Pan-European Seal Young Professionals Programme
          • Go back
          • Overview
          • For students
          • For universities
            • Go back
            • Overview
            • IP education resources
            • University memberships
          • Our young professionals
          • Professional development plan
        • Academic Research Programme
          • Go back
          • Overview
          • Completed research projects
          • Current research projects
        • IP Teaching Kit
          • Go back
          • Overview
          • Download modules
        • Intellectual property course design manual
        • PATLIB Knowledge Transfer to Africa
          • Go back
          • The PATLIB Knowledge Transfer to Africa initiative (KT2A)
          • KT2A core activities
          • Success story: Malawi University of Science and Technology and PATLIB Birmingham
  • About us
    • Go back
    • Overview
    • The EPO at a glance
    • 50 years of the EPC
      • Go back
      • Official celebrations
      • Overview
      • Member states’ video statements
        • Go back
        • Albania
        • Austria
        • Belgium
        • Bulgaria
        • Croatia
        • Cyprus
        • Czech Republic
        • Denmark
        • Estonia
        • Finland
        • France
        • Germany
        • Greece
        • Hungary
        • Iceland
        • Ireland
        • Italy
        • Latvia
        • Liechtenstein
        • Lithuania
        • Luxembourg
        • Malta
        • Monaco
        • Montenegro
        • Netherlands
        • North Macedonia
        • Norway
        • Poland
        • Portugal
        • Romania
        • San Marino
        • Serbia
        • Slovakia
        • Slovenia
        • Spain
        • Sweden
        • Switzerland
        • Türkiye
        • United Kingdom
      • 50 Leading Tech Voices
      • Athens Marathon
      • Kids’ collaborative art competition
    • Legal foundations and member states
      • Go back
      • Overview
      • Legal foundations
      • Member states
        • Go back
        • Overview
        • Member states by date of accession
      • Extension states
      • Validation states
    • Administrative Council and subsidiary bodies
      • Go back
      • Overview
      • Communiqués
        • Go back
        • 2024
        • Overview
        • 2023
        • 2022
        • 2021
        • 2020
        • 2019
        • 2018
        • 2017
        • 2016
        • 2015
        • 2014
        • 2013
      • Calendar
      • Documents and publications
        • Go back
        • Overview
        • Select Committee documents
      • Administrative Council
        • Go back
        • Overview
        • Composition
        • Representatives
        • Rules of Procedure
        • Board of Auditors
        • Secretariat
        • Council bodies
    • Principles & strategy
      • Go back
      • Overview
      • Mission, vision, values & corporate policy
      • Strategic Plan 2028
        • Go back
        • Driver 1: People
        • Driver 2: Technologies
        • Driver 3: High-quality, timely products and services
        • Driver 4: Partnerships
        • Driver 5: Financial sustainability
      • Towards a New Normal
      • Data protection & privacy notice
    • Leadership & management
      • Go back
      • Overview
      • About the President
      • Management Advisory Committee
    • Sustainability at the EPO
      • Go back
      • Overview
      • Environmental
        • Go back
        • Overview
        • Inspiring environmental inventions
      • Social
        • Go back
        • Overview
        • Inspiring social inventions
      • Governance and Financial sustainability
    • Procurement
      • Go back
      • Overview
      • Procurement forecast
      • Doing business with the EPO
      • Procurement procedures
      • Dynamic Purchasing System (DPS) publications
      • Sustainable Procurement Policy
      • About eTendering
      • Invoicing
      • Procurement portal
        • Go back
        • Overview
        • e-Signing contracts
      • General conditions
      • Archived tenders
    • Services & activities
      • Go back
      • Overview
      • Our services & structure
      • Quality
        • Go back
        • Overview
        • Foundations
          • Go back
          • Overview
          • European Patent Convention
          • Guidelines for examination
          • Our staff
        • Enabling quality
          • Go back
          • Overview
          • Prior art
          • Classification
          • Tools
          • Processes
        • Products & services
          • Go back
          • Overview
          • Search
          • Examination
          • Opposition
          • Continuous improvement
        • Quality through networking
          • Go back
          • Overview
          • User engagement
          • Co-operation
          • User satisfaction survey
          • Stakeholder Quality Assurance Panels
        • Patent Quality Charter
        • Quality Action Plan
        • Quality dashboard
        • Statistics
          • Go back
          • Overview
          • Search
          • Examination
          • Opposition
        • Integrated management at the EPO
      • Consulting our users
        • Go back
        • Overview
        • Standing Advisory Committee before the EPO (SACEPO)
          • Go back
          • Overview
          • Objectives
          • SACEPO and its working parties
          • Meetings
          • Single Access Portal – SACEPO Area
        • Surveys
          • Go back
          • Overview
          • Detailed methodology
          • Search services
          • Examination services, final actions and publication
          • Opposition services
          • Formalities services
          • Customer services
          • Filing services
          • Key Account Management (KAM)
          • Website
          • Archive
      • Our user service charter
      • European and international co-operation
        • Go back
        • Overview
        • Co-operation with member states
          • Go back
          • Overview
        • Bilateral co-operation with non-member states
          • Go back
          • Overview
          • Validation system
          • Reinforced Partnership programme
        • Multilateral international co-operation with IP offices and organisations
        • Co-operation with international organisations outside the IP system
      • European Patent Academy
        • Go back
        • Overview
        • Partners
      • Chief Economist
        • Go back
        • Overview
        • Economic studies
      • Ombuds Office
      • Reporting wrongdoing
    • Observatory on Patents and Technology
      • Go back
      • Overview
      • Innovation against cancer
      • Innovation actors
        • Go back
        • Overview
        • Startups and SMEs
      • Policy and funding
        • Go back
        • Overview
        • Financing innovation programme
          • Go back
          • Overview
          • Our studies on the financing of innovation
          • EPO initiatives for patent applicants
          • Financial support for innovators in Europe
        • Patents and standards
          • Go back
          • Overview
          • Publications
          • Patent standards explorer
      • Tools
        • Go back
        • Overview
        • Deep Tech Finder
      • About the Observatory
        • Go back
        • Overview
        • Work plan
    • Transparency portal
      • Go back
      • Overview
      • General
        • Go back
        • Overview
        • Annual Review 2023
          • Go back
          • Overview
          • Foreword
          • Executive summary
          • 50 years of the EPC
          • Strategic key performance indicators
          • Goal 1: Engaged and empowered
          • Goal 2: Digital transformation
          • Goal 3: Master quality
          • Goal 4: Partner for positive impact
          • Goal 5: Secure sustainability
        • Annual Review 2022
          • Go back
          • Overview
          • Foreword
          • Executive summary
          • Goal 1: Engaged and empowered
          • Goal 2: Digital transformation
          • Goal 3: Master quality
          • Goal 4: Partner for positive impact
          • Goal 5: Secure sustainability
      • Human
      • Environmental
      • Organisational
      • Social and relational
      • Economic
      • Governance
    • Statistics and trends
      • Go back
      • Overview
      • Statistics & Trends Centre
      • Patent Index 2024
        • Go back
        • Insight into computer technology and AI
        • Insight into clean energy technologies
        • Statistics and indicators
          • Go back
          • European patent applications
            • Go back
            • Key trend
            • Origin
            • Top 10 technical fields
              • Go back
              • Computer technology
              • Electrical machinery, apparatus, energy
              • Digital communication
              • Medical technology
              • Transport
              • Measurement
              • Biotechnology
              • Pharmaceuticals
              • Other special machines
              • Organic fine chemistry
            • All technical fields
          • Applicants
            • Go back
            • Top 50
            • Categories
            • Women inventors
          • Granted patents
            • Go back
            • Key trend
            • Origin
            • Designations
      • Data to download
      • EPO Data Hub
      • Clarification on data sources
    • History
      • Go back
      • Overview
      • 1970s
      • 1980s
      • 1990s
      • 2000s
      • 2010s
      • 2020s
    • Art collection
      • Go back
      • Overview
      • The collection
      • Let's talk about art
      • Artists
      • Media library
      • What's on
      • Publications
      • Contact
      • Culture Space A&T 5-10
        • Go back
        • Catalyst lab & Deep vision
          • Go back
          • Irene Sauter (DE)
          • AVPD (DK)
          • Jan Robert Leegte (NL)
          • Jānis Dzirnieks (LV) #1
          • Jānis Dzirnieks (LV) #2
          • Péter Szalay (HU)
          • Thomas Feuerstein (AT)
          • Tom Burr (US)
          • Wolfgang Tillmans (DE)
          • TerraPort
          • Unfinished Sculpture - Captives #1
          • Deep vision – immersive exhibition
          • Previous exhibitions
        • The European Patent Journey
        • Sustaining life. Art in the climate emergency
        • Next generation statements
        • Open storage
        • Cosmic bar
      • "Long Night"
  • Boards of Appeal
    • Go back
    • Overview
    • Decisions of the Boards of Appeal
      • Go back
      • Overview
      • Recent decisions
      • Selected decisions
    • Information from the Boards of Appeal
    • Procedure
    • Oral proceedings
    • About the Boards of Appeal
      • Go back
      • Overview
      • President of the Boards of Appeal
      • Enlarged Board of Appeal
        • Go back
        • Overview
        • Pending referrals (Art. 112 EPC)
        • Decisions sorted by number (Art. 112 EPC)
        • Pending petitions for review (Art. 112a EPC)
        • Decisions on petitions for review (Art. 112a EPC)
      • Technical Boards of Appeal
      • Legal Board of Appeal
      • Disciplinary Board of Appeal
      • Presidium
        • Go back
        • Overview
    • Code of Conduct
    • Business distribution scheme
      • Go back
      • Overview
      • Technical boards of appeal by IPC in 2025
      • Archive
    • Annual list of cases
    • Communications
    • Annual reports
      • Go back
      • Overview
    • Publications
      • Go back
      • Abstracts of decisions
    • Case Law of the Boards of Appeal
      • Go back
      • Overview
      • Archive
  • Service & support
    • Go back
    • Overview
    • Website updates
    • Availability of online services
      • Go back
      • Overview
    • FAQ
      • Go back
      • Overview
    • Publications
    • Ordering
      • Go back
      • Overview
      • Patent Knowledge Products and Services
      • Terms and conditions
        • Go back
        • Overview
        • Patent information products
        • Bulk data sets
        • Open Patent Services (OPS)
        • Fair use charter
    • Procedural communications
    • Useful links
      • Go back
      • Overview
      • Patent offices of member states
      • Other patent offices
      • Directories of patent attorneys
      • Patent databases, registers and gazettes
      • Disclaimer
    • Contact us
      • Go back
      • Overview
      • Filing options
      • Locations
    • Subscription centre
      • Go back
      • Overview
      • Subscribe
      • Change preferences
      • Unsubscribe
    • Official holidays
    • Glossary
    • RSS feeds
Board of Appeals
Decisions

Recent decisions

Overview
  • 2025 decisions
  • 2024 decisions
  • 2023 decisions
  1. Home
  2. T 0067/11 (Humanized antibodies / CENTRO DE INMUNOLOGIA MOLECULAR) 26-05-2014
Facebook X Linkedin Email

T 0067/11 (Humanized antibodies / CENTRO DE INMUNOLOGIA MOLECULAR) 26-05-2014

European Case Law Identifier
ECLI:EP:BA:2014:T006711.20140526
Date of decision
26 May 2014
Case number
T 0067/11
Petition for review of
-
Application number
04728755.2
IPC class
C07K 16/46
A61K 39/395
Language of proceedings
EN
Distribution
NO DISTRIBUTION (D)

Download and more information:

Decision in EN 393.27 KB
Documentation of the appeal procedure can be found in the European Patent Register
Bibliographic information is available in:
EN
Versions
Unpublished
Application title

Recombinant antibodies and fragments recognising N-glycolyl-GM3 and use thereof in the diagnosis and treatment of tumours

Applicant name
Centro de Inmunologia Molecular
Opponent name
-
Board
3.3.04
Headnote
-
Relevant legal provisions
European Patent Convention Art 56
Keywords
Inventive step - (yes)
Catchword
-
Cited decisions
-
Citing decisions
T 1913/16
T 1171/18

I. The appeal lies from the decision of the examining division to refuse European patent application No. 04728755.2 (hereinafter referred to as "application as filed") with the title "Recombinant antibodies and fragments recognising ganglioside N-glycolyl-GM3 and use thereof in the diagnosis and treatment of tumours" which was published as WO2004/094477. The examining division decided that the subject-matter of claims 1 to 9 of the request before it lacked an inventive step (Article 56 EPC).

Independent claim 1 of this request read:

"1. A recombinant humanized antibody comprising the constant region of the IgG1 human heavy chain and the constant region of the Ck human light chain and heavy and light chain variable regions derived from the murine 14F7 monoclonal antibody produced by the hybridoma with the deposit ECACC98101901, wherein the murine 14F7 monoclonal antibody comprises the sequences of the hyper variable regions (CDRs) of the heavy and light chains shown below:

HEAVY CHAIN

CDR1: SYWIH

CDR2: YIDPATAYTESNQKFKD

CDR3: ESPRLRRGIYYYAMDY

LIGHT CHAIN

CDR1: RASQSISNNLH

CDR2: YASQSIS

CDR3: QQSNRWPLT;

and the murine 14F7 monoclonal antibody comprises the sequences of the framework regions (FRs) of the heavy and light chains shown below:

HEAVY CHAIN

FR1: QVQLQQSGNELAKPGASMKMSCRASQYSFT

FR2: WLKQRPDQGLEWIG

FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR

FR4: WGQGTTVTVSS

LIGHT CHAIN

FRl: DLVLTQSPATLSVTPGDSVSFSC

FR2: WYQQRTHESPRLLIK

FR3: GIPSRFSGSGSGTDFTLS1ISVETEDFGMYFC

FR4: FOAGTKLELKRA;

wherein the recombinant humanized antibody comprises point mutations in the FRs of the heavy and light chains to reduce immunogenicity."

Independent claim 3 was directed to a single chain fragment (scFv) derived from the murine antibody 14F7 with the same sequences of the hyper variable regions and the framework regions as defined in claim 1. Claims 5 and 6 referred to particular scFvs, i.e. 2Am scFv and 3Fm scFv (claim 5) and 7Bhk scFv and 7Ahl scFv (claim 6). Independent claim 7 was directed to a cell line expressing the recombinant antibody or the single chain Fv fragment of any of claims 1 to 6. Independent claim 8 was directed to a pharmaceutical composition for use in the treatment of malignant tumors comprising the recombinant antibody or the single chain Fv fragment of any of claims 1 to 6.

II. The following documents are cited in this decision:

D1: EP-A-0 972 782

D2: EP-A-1 013 761

D6: Kabat et al. (1991), The Journal of Immunology,

Vol. 147, No.5, pages 1709-1719.

D7: Winter et al. (1993), Immunology Today, Vol. 14,

No. 6, pages 243-246.

D14: Damschroeder et al. (2007), Molecular Immunology,

Vol. 44, pages 3049-3060.

III. With the statement of the grounds of appeal the appellant maintained the main request refused by the examining division and filed two auxiliary requests.

IV. At a later date, the appellant filed a third auxiliary request and submitted four documents.

V. In a communication pursuant to Article 17(1) RPBA the board expressed its preliminary and non-binding opinion that the subject-matter of the claims of all the requests on file lacked an inventive step (Article 56 EPC), was not clear and lacked support in the application (Articles 84 EPC) and that the invention was insufficiently disclosed in the application as filed (Article 83 EPC).

VI. The appellant replied on 6 December 2013 and submitted auxiliary request IV (claims 1 to 5), further technical data and arguments in favour of inventive step.

VII. In a brief telephone conversation with the representative, the rapporteur informed the appellant of the preliminary opinion of the board. Subsequently, the appellant withdrew the main request and the first three auxiliary requests. Auxiliary request IV was maintained as the sole request.

Claim 1 of this sole request read:

"1. A recombinant humanized antibody that recognizes the NGcGM3 ganglioside comprising the constant region of the IgG1human heavy chain and the constant region of the Ck human light chain and heavy and light chain variable regions from the murine 14F7 monoclonal antibody produced by the hybridoma with the deposit ECACC 98101901, wherein the murine 14F7 monoclonal antibody comprises the sequences of the hyper variable regions (CDRs) of the heavy and light chains shown below:

HEAVY CHAIN

CDR1: SYWIH

CDR2: YIDPATAYTESNQKFKD

CDR3: ESPRLRRGIYYYAMDY

LIGHT CHAIN

CDR1: RASQSISNNLH

CDR2: YASQSIS

CDR3: QQSNRWPLT

and the murine 14F7 monoclonal antibody comprises the sequences of the framework regions (FRs) of the heavy and light chains shown below:

HEAVY CHAIN

FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT

FR2: WLKQRPDQGLEWIG

FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR

FR4: WGQGTTVTVSS

LIGHT CHAIN

FR1: DLVLTQSPATLSVTPGDSVSFSC

FR2: WYQQRTHESPRLLIK

FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC

FR4: FGAGTKLELKRA;

wherein the recombinant humanized antibody is characterized by containing the sequence of the variable region of the heavy chain of the murine 14F7 monoclonal antibody and a light chain variable region whose sequence is the following:

Fr1 DIQMTQTPSSLSASLGDRVTISC

CDR1 RASQDISNYLN

Fr2 WYQQKPDGTVKLLIV

CDR2 YTSRLHS

Fr3 GVPSRFSGSGSGTDYSLTISNLEQEDIATYFC

CDR3 QQGNTLPPTF

Fr4 GAGTKLELK

or:

Fr1 DIQMTQTPSSLSASVGDRVTITC

CDR1 RASQSISSFLN

Fr2 WYQQKPGKAPKLLIY

CDR2 AASNLQS

Fr3 GVPSRFSGRGSGTDFTLTISSLQPEDFAAYYC

CDR3 QQGYTTPLTF

Fr4 GQGTKLELK

or:

Fr1 QSVVTQPPSASGGPGQSLTISC

CDR1 TGTSSDVGGYNHVS

Fr2 WYQQHPGKAPKLMIY

CDR2 DVSKRPS

Fr3 GVPHRFSGSKSGNTASLTVSGLQAEDEAVYYC

CDR3 SSYAGSNNLVF

Fr4 GGGTKVTVL"

Independent claim 2 related to a single chain Fv fragment wherein the sequences of the light chain variable region were as defined in claim 1. Independent claim 3 was directed to a cell line expressing the recombinant antibody or the single chain Fv fragment of claims 1 or 2. Independent claim 4 related to a pharmaceutical composition for use in the treatment of malignant tumors comprising the recombinant antibody or the single chain Fv fragment of claims 1 or 2. Claim 5 was dependent on claim 4.

VIII. The appellant's arguments can be summarised as follows:

Amendments (Article 123(2) EPC, clarity (Article 84 EPC), sufficiency of disclosure (Article 83 EPC) and novelty (Article 54 EPC)

The requests complied with all the requirements of Article 54, 83, 84 and 123(2) EPC.

Inventive step (Article 56 EPC)

At the filing date numerous options existed for antibody modifications, but the downsides of such modifications for a specific antibody were not predictable. In particular, it was well known in the art that the modification of antibodies or single chain fragments often resulted in a significant decrease of their affinity.

In view of the prior art, the skilled person would have avoided introducing point mutations in the framework regions (FR) of the antibody.

There were few examples of humanised antiganglioside antibodies, which could be due to the high complexity of the antigen-binding characteristics in the case of carbohydrate-binding antibodies.

The skilled person would have expected that the humanized antibody with the best affinity properties would be the variant with less mutations with respect to the murine antibody.

IX. The appellant requested that the decision under appeal be set aside and that a patent be granted on the basis of the request submitted on 6 December 2013 as auxiliary request IV (see section VII).

1. The appeal is admissible.

Amendments (Article 123(2) EPC)

2. Present claim 1 has a basis in claims 1 and 2 and in example 7 on pages 19 to 20 of the application as filed. Moreover, it contains the additional feature that the antibody "recognizes the NGcGM3 ganglioside", which is based on page 1, lines 8 to 9 of the description as filed and numerous references to the same antigen throughout the same.

3. The specific sequences cited in claim 1 which were originally disclosed in example 7 correspond also to the fragments set forth in claims 12, 14 and 15 as filed. The board is satisfied that the choice of these three embodiments does not amount to an intermediate generalisation, since all the elements characterising each specific antibody are included in claim 1.

4. The three alternatives of claim 2 find their basis in claims 12, 14 and 15 as filed. Claims 3 to 5 are based on claims 17 to 19 as filed.

5. In view of the above considerations, amended claims 1 to 5 comply with the requirements of Article 123(2) EPC.

Clarity, sufficiency of disclosure and novelty (Articles 84, 83 and 54 EPC, respectively)

6. In its decision, the examining division did not express any negative opinion under Articles 54, 83 or 84 EPC.

7. The board considers the claims clear (Article 84 EPC) since a skilled person is in a position to unambiguously identify an antibody, fragment or pharmaceutical composition containing these falling within the scope of the claims. The board considers furthermore that the application sufficiently discloses the novel antibodies of claim 1 and the novel single chain Fv fragments of claim 2 (Articles 54 and 83 EPC). Hence, the board is satisfied that these requirements of the EPC are met.

Inventive step (Article 56 EPC)

8. The idea underlying the present invention is the provision of an antibody which recognizes the same antigen as the murine antibody 14F7 with the same affinity but which is less immunogenic when administered to patients (page 4, lines 11 to 13 of the description). This is achieved by the replacement of the constant regions of the murine antibody by particular human constant regions and by the replacement of specific "murine" amino acids in the variable FR regions by "human" amino acids (see page 5 of the description, line 17 to page 6, line 16). The invention is accordingly claimed in claim 1.

Closest prior art

9. The examining division considered document (D1) to represent the closest prior art. The board agrees, since this document discloses the murine monoclonal antibody 14F7 (the original antibody on which the presently claimed modified antibody is based), pharmaceutical compositions comprising it and their use for treating cancer and is hence considered the most promising springboard among the documents cited.

Technical problem and its solution

10. The recombinant humanised antibody of claim 1 (or the single chain Fv fragment of claim 2) and the antibody disclosed in document (D1) differ in that the former has particular human heavy and light chain constant regions and that the FRs of the heavy and light chains contain certain specific point mutations. The technical effects of these differences are, according to the application as filed (see page 4, lines 11 to 13), reduced immunogenicity in humans as compared to the murine antibody of document (D1) while maintaining a similar affinity towards the antigen.

11. Starting from document (D1), the problem to be solved is thus the provision of an antibody with an affinity towards the N-glycolil GM3 ganglioside which is similar to that of 14F7 but which is less immunogenic when administered to human patients.

12. At the relevant date, it was generally accepted in the art that the replacement of mouse constant regions and variable domain regions by human sequences results in less immunogenic antibodies when administered to the patient (see e.g. paragraphs [0007] and [0008] of document (D2) and page 243, right-hand column, first and second full paragraph of document (D7)). Hence, concerning the overall reduction of immunogenicity, the board is satisfied that the subject-matter of claims 1 and 2 solves this part of the problem.

13. With respect to the level of affinity to the target antigen, the board notes that although example 7 and Figure 8 identify the three specific light chain variable fragments defined in claims 1 and 2 as particularly relevant for the invention and demonstrate their specificity to the N-glycolil GM3 antigen, the application as filed does not include any particular experimental measurement of the binding affinity of said fragments. However, on the basis of the facts before it, the board has no reason to doubt that they conserve the binding affinity to the antigen of the murine antibody. Indeed, the data submitted by the appellant on 16 December 2013 demonstrate and confirm that for the three specific single chain Fv fragments defined in the claimed subject-matter (ScFv 3Fm, ScFv 7Bhk and ScFv 7Ahl), the dissociation constant is indeed similar or lower than the value of the murine 14F7 antibody, which was used as a reference. The smaller the dissociation constant of an antibody, the more tightly it is bonded to the antigen. Hence, the values obtained indicate that the affinity towards the N-glycolil GM3 antigen of ScFv 3Fm, ScFv 7Bhk and ScFv 7Ahl is the same or higher than that of the reference murine 14F7 antibody.

14. The board is therefore satisfied that the subject-matter of claims 1 and 2 provides a solution to the problem formulated in point 11 above.

Obviousness

15. The examining division argued its inventive step objection in relation to the subject-matter of the claims before it (see section I) starting from the disclosure of the murine antibody 14F7 in document (D1) and combining it with the common general knowledge of the skilled person about humanization of antibodies as reported in documents (D2) or (D7). The examining division held that, at the priority date of the application, the skilled person would have been able to obtain and select recombinant humanised antibodies based on the murine 14F7 antibody by replacing the mouse constant regions by human sequences and providing point mutations in the FRs of the heavy and light chains applying standard knowledge and technology and accordingly would also be able to obtain a cell line expressing those antibodies and pharmaceutical compositions containing them and to use those compositions for cancer treatment. Moreover, in the absence of any particular technical effect linked to the specific mutations cited in the claims before it, the claimed antibody sequences were regarded as arbitrary selections which could not render the antibodies inventive over the prior art.

16. The claims now before the board (see section VII) comprise extensive amendments as compared to the claims considered by the examining division (see section I). In particular, the general reference to point mutations in the FRs of the heavy and light chains in former independent claim 1 (and claim 3) has been replaced by three specific embodiments with defined specific sequences of the light chain variable region. These amendments aim at addressing the objections under Article 56 EPC raised by the examining division in the impugned decision.

17. The drawbacks of rodent monoclonal antibodies (and their consequential limited clinical utility) that had motivated the development of humanised monoclonal antibodies, namely a short blood half-life and their immunogenicity in humans were well known in the art (see e.g. document (D7), page 243, left-hand column, lines 11 to 16). Hence, the board agrees with the examining division that the preparation of humanised chimeric antibodies by recombining variable domains of murine antibodies with constant domains of human antibodies in order to reduce the immunogenicity of the murine antibodies was part of the standard knowledge and technology.

18. It was also generally known in the art that the process of humanisation of murine antibodies could result in a significant loss of binding affinity to the antigen. Document (D7) reviews this point on pages 243 and 244 in the part titled "Building humanized antibodies" and mentions several strategies to recover at least part of the lost affinity, by methodologies including framework substitutions, chain shuffling or random mutations. The board notes however that document (D7) does not disclose any preference for a particular approach but rather that any of these strategies may be of general application for all antibodies.

19. The board considers therefore that, at the relevant date, the skilled person had a clear incentive to attempt humanisation of a potentially interesting therapeutic antibody.

20. While the possibility of carrying out mutations in framework residues is clearly suggested in the prior art as a possible route to improve antigen recognition on page 244 of document (D7), for the purpose of assessing obviousness of the claimed subject-matter, it still needs to be determined whether the prior art provides clear instructions to the skilled person to obtain the specific mutations recited in the claims, i.e. whether such mutations were obvious possibilities for the person skilled in the art faced with the problem defined in point 11 above.

21. In this context, the following facts and considerations are of relevance:

21.1 Studies in the prior art in respect of the contribution of the variable domains of the heavy and light antibody chains on the specificity of antibody-antigen binding warn the skilled person that "a single amino acid change may seriously disrupt site structure and in some instances abolish binding" (see document (D6); in particular lines 18 to 21 of the abstract).

21.2 Based on the documents available to the board, it would appear that, even years after the filing of the present application no methodical study of the effects of humanisation on antibody binding, activity, stability and biophysical properties have been undertaken in the art and even less that a particular "recipe" for reducing the immunogenicity of a specific antibody while not affecting or improving the affinity and specificity of this antibody has been disclosed (see document (D14), page 3049, right-hand column). This appears all the more true for humanised anti-ganglioside antibodies, of which only very few examples had been successfully prepared at the relevant date of the application.

21.3 The technical data submitted by the appellant (see point 12 above) relates to five antibody fragments with various particular point mutations in the FR region. The three which are now claimed have the desired binding affinity similar to the murine monoclonal antibody 14F7, whereas two further embodiments with slightly different mutations have a dissociation constant much higher than that of 14F7, i.e. they have less affinity for the antigen. These results would therefore seem to corroborate the general warning in the prior art that minor structural differences involve significant functional consequences which the skilled person could not have predicted.

22. Accordingly, and taking into account the above facts and considerations, the board judges that in the present context the possibility of mutating some residues in the framework region was likely to have been considered by the skilled person when attempting the humanization of the 14F7 antibody with the aim of maintaining the affinity to the antigen. It would appear, however, that the prior art failed to provide the skilled person with any pointer towards any specific set of mutations which would do the job.

23. In accordance with the case law of the boards of appeal, a course of action is considered obvious within the meaning of Article 56 EPC if for the skilled person its results are clearly predictable or there is a reasonable expectation of success that the results be achieved. It has been established, and this board agrees, that such a reasonable expectation of success implies the ability of the skilled person to predict rationally, on the basis of the knowledge existing before a research project was started, the successful conclusion of the said project within acceptable time limits. The more unexplored a technical field of research is, the more difficult it is to make predictions about its successful conclusion and consequently, the lower the expectation of success is (see Case Law of the Boards of Appeal of the EPO, 7th edition 2013, section I.D.7.1).

24. Accordingly, the expectation of success is inversely related to the difficulty of predicting the successful resolution of a technical problem and is inherently low in cases like the present one where minor changes (point mutations) bring about major differences on the final technical effect and where there is no guidance from the prior art concerning the impact of such possible changes. In the present case, and on the basis of the prior art and citations available, the board considers that the skilled person had no means to predict the impact of each possible mutation in the FR of the antibody on the final properties of the antibody or antibody fragment. In these technical circumstances, it is the attainment of an antibody (or antibody fragment) having indeed the desired characteristics which is considered surprising, not the theoretical possibility of achieving one.

25. Accordingly, the board judges that the subject-matter of claims 1 and 2 involves an inventive step on the basis of the prior art available. The same applies to the subject-matter of claim 3 to 5, which refer to the antibody or antibody fragments of claims 1 and 2.

Order

For these reasons it is decided that:

1. The decision under appeal is set aside.

2. The case is remitted to the examining division with the order to grant a patent on the basis of claims 1 to 5 of auxiliary request IV, filed with the letter dated 6 December 2013, after any necessary consequential adaptation of the description.

Footer - Service & support
  • Service & support
    • Website updates
    • Availability of online services
    • FAQ
    • Publications
    • Procedural communications
    • Contact us
    • Subscription centre
    • Official holidays
    • Glossary
Footer - More links
  • Jobs & careers
  • Press centre
  • Single Access Portal
  • Procurement
  • Boards of Appeal
Facebook
European Patent Office
EPO Jobs
Instagram
EuropeanPatentOffice
Linkedin
European Patent Office
EPO Jobs
EPO Procurement
X (formerly Twitter)
EPOorg
EPOjobs
Youtube
TheEPO
Footer
  • Legal notice
  • Terms of use
  • Data protection and privacy
  • Accessibility